SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001648 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001648
Domain Number 1 Region: 179-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.06e-53
Family Voltage-gated potassium channels 0.00079
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.39e-31
Family Tetramerization domain of potassium channels 0.000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001648   Gene: ENSCPOG00000001820   Transcript: ENSCPOT00000001841
Sequence length 654
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:36183268:36381341:-1 gene:ENSCPOG00000001820 transcript:ENSCPOT00000001841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPTDKNKRQDELIILNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRA
QKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLH
CLEKTTGLSYLVDDPLLSVRTSIIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHPG
LTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGL
RPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
Download sequence
Identical sequences H0UX48
ENSCPOP00000001648 10141.ENSCPOP00000001648 ENSCPOP00000001648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]