SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001720 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001720
Domain Number 1 Region: 3-121
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-32
Family C-type lectin domain 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001720   Gene: ENSCPOG00000001903   Transcript: ENSCPOT00000001924
Sequence length 124
Comment pep:novel scaffold:cavPor3:scaffold_28:3817391:3825419:1 gene:ENSCPOG00000001903 transcript:ENSCPOT00000001924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESYCGPCPKNWICYKNSCYQFFHEKKNWYQSQASCVFQNSSLLKIYSRVDQDFFKLVKSF
HWMGLVQIPKTRSWHWEDGSVLSPDQLTLMDTQNGKCALYGSNFKGYTENCSTPYPYICM
QRTV
Download sequence
Identical sequences 10141.ENSCPOP00000001720 ENSCPOP00000001720 ENSCPOP00000001720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]