SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001806 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001806
Domain Number 1 Region: 155-316,354-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-38
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 9-74
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000785
Family Flavin-binding PAS domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001806   Gene: ENSCPOG00000001998   Transcript: ENSCPOT00000002024
Sequence length 422
Comment pep:known_by_projection scaffold:cavPor3:scaffold_20:7847874:7900991:-1 gene:ENSCPOG00000001998 transcript:ENSCPOT00000002024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNNILFYSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYSVSGTPVWFYMQIAPIRNEH
EKVVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVAHKH
SRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSF
KTKQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLL
SCLPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGL
VAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNSSAGIWEGGPSKDSL
YVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGCKYLFFPFSKMFCWQCFTFQKQ
TG
Download sequence
Identical sequences 10141.ENSCPOP00000001806 ENSCPOP00000001806 ENSCPOP00000001806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]