SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001948 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001948
Domain Number 1 Region: 85-652
Classification Level Classification E-value
Superfamily Urocanase 1.44e-218
Family Urocanase 0.0000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001948   Gene: ENSCPOG00000002151   Transcript: ENSCPOT00000002179
Sequence length 677
Comment pep:known_by_projection scaffold:cavPor3:scaffold_16:18177560:18209000:1 gene:ENSCPOG00000002151 transcript:ENSCPOT00000002179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLQMLCSGLPLWPLPQNQGRWAGVPHAPVRTPNLSPAEEQLALRNALRYFPPDIQELL
AQEFAQELRLYGHIYMYRFSPSIEMRAYPIEQYPCRTRAAAAIMHMIMNNLDPAVAQFPQ
ELVTYGGNGQVFSNWAQFWLTMYYLSKMTEEQTLVMYSGHPLGLFPSSPGAPRLVITNGM
VIPNYSSRTEYEKLFALGVTIMRTQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGVEDL
AGKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALVKRHQQGWLMEVTDSLDHCIGR
LREARKNKEVLSLGYHGNVVDLWERLVHELDTTGELLVDLGSDQTSCHNPFNGGYYPVQL
SFVEAQRLMASNPPAFKDLVQESLRRHISAINRLAKENFFFWDYGNAFLLEAHRAGADVA
KKDAKKMEFRYPSYVQHIMGDIFSQGFGPFRWVCTSGDPQDLAVTDQLAASVLEKAIADG
VKASVKLQYMDNIRWIREAAKHQLVVGSQARILYSDQKGRVAIAVAINQAIANGKIKAPV
VLSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGWGE
VINGGFGLMLDGSPEAEYKARMMLSWDVSNGVARRCWSGNPKAYEIICQTMQENSGLEVT
LPHDVTDECMLQQALQP
Download sequence
Identical sequences 10141.ENSCPOP00000001948 ENSCPOP00000001948 ENSCPOP00000001948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]