SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001977 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000001977
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.012
Family Molybdopterin synthase subunit MoaE 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001977   Gene: ENSCPOG00000002181   Transcript: ENSCPOT00000002209
Sequence length 184
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:12190566:12191117:1 gene:ENSCPOG00000002181 transcript:ENSCPOT00000002209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKDYTHSRPQAQRVI
KDLVKVAVKVAVLHRNGCFGPGELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLL
TECRDVLLELVGHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLD
EGKL
Download sequence
Identical sequences A0A286XEQ0
ENSCPOP00000001977 ENSCPOP00000001977 XP_004632435.1.9945 XP_005007840.1.53824 XP_012998534.1.53824 10141.ENSCPOP00000001977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]