SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001979 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001979
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.000000118
Family LysM domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001979   Gene: ENSCPOG00000002183   Transcript: ENSCPOT00000002211
Sequence length 228
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:12192658:12200819:-1 gene:ENSCPOG00000002183 transcript:ENSCPOT00000002211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPSLGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLKPEDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEEVHPRKNEARPSS
AERSKQEMGSEPAKGDSVPPTPGQDPPGPTHDLSASDFLKKLDSQISLSKKVATQKLSKG
ESGVPREDAHLHLSSPRTQQRAVLGPVPLTRTSRTRMLRDQEDEIFKL
Download sequence
Identical sequences A0A286Y214
ENSCPOP00000001979 10141.ENSCPOP00000001979 XP_005007839.1.53824 ENSCPOP00000001979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]