SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002048 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002048
Domain Number 1 Region: 43-196
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.92e-79
Family Hedgehog (development protein), N-terminal signaling domain 0.00000027
Further Details:      
 
Domain Number 2 Region: 201-347
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.81e-37
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002048   Gene: ENSCPOG00000002257   Transcript: ENSCPOT00000002289
Sequence length 397
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:50481610:50485696:1 gene:ENSCPOG00000002257 transcript:ENSCPOT00000002289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APMALPASLLPLCCLALLTLPAQSCGPGRGPVGRRRYGRKQPVPLLYKQFVPSVPERTLG
ASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMW
PGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYES
RNHVHVSVKADNSLAVRAGGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVPTP
VLLFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPEPGDFAPVFARRLRAGD
SVLAPGGGALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFA
PLRLLHALGALLPGGSVQPTGMHWYSRLLYRLAEELL
Download sequence
Identical sequences 10141.ENSCPOP00000002048 ENSCPOP00000002048 ENSCPOP00000002048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]