SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002084 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002084
Domain Number 1 Region: 474-1006
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.55e-147
Family alpha-mannosidase, C-terminal domain 0.00000000000575
Further Details:      
 
Domain Number 2 Region: 49-383
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.97e-119
Family alpha-mannosidase 0.0000000000401
Further Details:      
 
Domain Number 3 Region: 386-491
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 4.9e-29
Family alpha-mannosidase, domain 2 0.00000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002084   Gene: ENSCPOG00000002295   Transcript: ENSCPOT00000002327
Sequence length 1012
Comment pep:novel scaffold:cavPor3:scaffold_42:13498371:13516882:1 gene:ENSCPOG00000002295 transcript:ENSCPOT00000002327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASVLPLGLGAGDCQSSSGRRMSACLPRTALSFLLSLLLATPGARAAGYETCPIVQPGM
LNVHLVAHTHDDVGWLKTVDQYYWGIHNDLQQAGVQYILDSVISALLAEPTRRFVYVEMA
FFSRWWHQQTNETQEVVRRLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDT
FGSDGRPRVAWHIDPFGHSREQASLFAQMGFDGVFFGRIDYQDKLVRKKRREMELVWRAS
ASLKAPAADLFTGVLPNNYGPPEGLCWDVLCADPPVVDDPRSPEYNAKKLVSYFLQLATA
QGRYYRTNHTVMTMGSDFQYENANTWFKNLDKLIQLVNMQQQANGSRVHVLYSTPACYLW
ELNKANLTWPVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQLEAQVGP
AANVGPYGHGDSSPLNQAMAVLQHHDAVSGTSKQHVADDYARQLAAGWGPCEVLLSNALA
KLSGSKETFLFCRDLNISICPFSQTSERFQVLVYNPLGRKVDRMVRLPVRKGLFLIKDPG
NNTVPSTASIYPSIHLLSGNPELLFPALVPALGFSVYSVTRVSDQNPQTRSQHSRPQKYS
SPVLSIKNEYLRASFHPDTGLLSMIEVLDRKLTLPVNQAFFWYNASVGDKRSSQASGAYI
FRPSQQWPFPVSHLARTRLVKTALVQEVHQNFTAWCSQVVRLYSGQRHLELEWTVGPIPV
GDKWGKEIISRFDTPLETGGVFFTDSNGREVLERRRDYRPSWKLNQTEPVAGNYYPVNSR
IYITDGKMQLTVLTDRSQGGSSMSDGSLELMVHRRLLKDDGRGVGEALQEPGSGGWVRGR
HLLLLDTAREAAAEHRLLAEKELLAPQLVLAPGQGPSYHHDHHEAVPRKQFSGLRRQLPP
SVRLLTLARWGPDTLLLRLEHQFALGEDSSRNLSLPVTLDLQDLFSTFTITRLQETTLAA
NQLRASASRLKWTTEIDPISRPAVPRLDPSSITLQPMEIRTFVASVQWEENS
Download sequence
Identical sequences 10141.ENSCPOP00000002084 ENSCPOP00000017509 ENSCPOP00000002084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]