SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002086 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002086
Domain Number 1 Region: 2-357,387-405
Classification Level Classification E-value
Superfamily Thiolase-like 4.05e-75
Family Thiolase-related 0.0013
Further Details:      
 
Domain Number 2 Region: 2217-2493
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.73e-64
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000347
Further Details:      
 
Domain Number 3 Region: 494-619,682-779
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.12e-42
Family FabD-like 0.0026
Further Details:      
 
Domain Number 4 Region: 1631-1790
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.21e-40
Family Alcohol dehydrogenase-like, C-terminal domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1873-2059
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.38e-35
Family Tyrosine-dependent oxidoreductases 0.00014
Further Details:      
 
Domain Number 6 Region: 1548-1665
Classification Level Classification E-value
Superfamily GroES-like 8.38e-17
Family Alcohol dehydrogenase-like, N-terminal domain 0.0039
Further Details:      
 
Domain Number 7 Region: 1207-1394
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.18e-16
Family Plant O-methyltransferase, C-terminal domain 0.097
Further Details:      
 
Domain Number 8 Region: 2114-2179
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000222
Family Acyl-carrier protein (ACP) 0.00026
Further Details:      
 
Domain Number 9 Region: 619-675
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000471
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002086   Gene: ENSCPOG00000002297   Transcript: ENSCPOT00000002329
Sequence length 2503
Comment pep:known_by_projection scaffold:cavPor3:scaffold_76:6482886:6497275:-1 gene:ENSCPOG00000002297 transcript:ENSCPOT00000002329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLHEFWANLIGGVDMVTDDDRRWKAGLYGLPRRCGKLKDLSKF
DASFFGVHPKQAQTMDPQIRLLLEVAYEAIVDAGINPSSLRGTNTGVWVGVSGSEASEAL
SRDPETLVGYSMVGCQRAMMANRISFFFDFKDTGPSIALDTACSSSLMALHNAYQAIRSG
ECPAAIVGGINTLLKPNTSVQFMKLGMLSPDGMCKSFDQTGNGYCRSEAVVAVLLTKKSL
ARRVYATVLNTGTNTDGSKEQGVTFPSGEAQKQLIRSLYLPAGPAPESLEYIEAHGTGTK
VGDPQELNSIAQVLCASRQDPLLIGSTKSNMGHPEPASGLAALTKVLLCLEHGVWAPNLH
FHTPNSEIPALTDGRLQVVDRPLPVRGGNVSINSFGFGGANVHVILQPNTKLAPVPAPHA
ALPRLLQASGRTLEAVQSLLEQGRQHSQDLAFVSMLNDIAATSPTAMPFRGYAVLGVEGG
GQEVQQVPSGKHPLWFICSGMGTQWCGMGVSLMRLDGFRDSILRSDEALKPVGLKVSKLL
LSTEENTFDDVVHALVSLTAIQIALLDLLTSMGLRPDGIIGHSLGEVACAYADGCVSQEE
AVLAAYWRGQCVKEASLPSGTMAAVGLSWEECKQRCPPGIVPACHNSEDTVTISGPQAAV
SKFVEQLKQEGVFAKEVQTGGIAFHSYFMEAIAPALLQALKKVIQAPRPRSARWLSTSIP
EAQWQGSLARTFSAEYNVNNLVSPVLFQEALRHIPEHAVVVEIAPHALLQAVLKRGLKPS
CTIVPLMRRDHKNNLEFFLTNIGKLHLVGINANPNALLPPVEFPAPRGTPLISPHIKWDH
SQTWDVPAAEHFPNGSGSSSATVYNIDAGPESPDHYLLDHCIDGRVLFPATGYLYLVWKT
LARNLSLPLEQTPVVFEGVTVHQATILPRTGTVPLEVRLLKAAHAFEVSHNGNLVVSGKA
YQWEDPDPKLFNHPEDPGPMEPEPTSHLSLADVYKELRLRGYEYGPHFQGVLQASFRGKQ
GKLLWKDNWVTFLDAMLQITILSMNQRSLYLPTRITDMRIDPTVHLQKVYTLQDETQVVD
VVSSAVNRIVAGGVYILQLHTTSAPRRQQESMVPTLEKFCFTPHLEAGCLSQSETLQGEL
QLCKGLAQALQTKAAQQGPQMVVPELDETQTQQGLPRLLAAACQLQLNGNLQQALAQERA
LLPEDPLLSGLLNSPALKACLDTALENLPSMKMKVVEVLAGDGHLYSRIPALLTTHPMLQ
LDYTATDRHPQALEAIQGRLHEHEVAQGQWDPADPAPSSLGAADLLVCNGAVATLGDPAL
ALANMTAALKEGGFLLLHTVLRGHTLGETLAFLTSELQSGPSLLSQDEWESLFSKAALHL
VGQKTSFYGSAIFLCRRPAPQDNPIFLPVEDTSFQWVDSLKDILAEMSPRPVWLTALGCP
TSGVVGMVNCLRKEPGGHRIRCILLSNLSSTSHVPKMDPGSAELQKVLEGDLVMNVYRDG
VWGAFRFSFLDQDRPQEQTAHAFVNILTRGDLSSIRWVCSPLKYARPTSPETQLCTVYYA
SLNFRDIMLATGKLSPDAIPGKSINRDCLLGMEFSGRDALGRRVMGLVPSEGLATSILVS
SAFLWEVPSSWTLEEAASVPVVYSTAYYALVARGRIKPGETVLIHSGSGGVGQAAITIAL
SLGCRVFTTVGSAEKRVYLRARFPQLDDTSFANSRDTSFEQHVMLHTGGRGVDLVLNSLA
EEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLKNVTFHGILLDALMEKNSPQWNE
VSALLQAGIRDGVVQPLKCTVFPKAKVEDAFRYMAQGKHIGKVLVQVHEEEQESRLQGAQ
PTPMVAISKTFFPSHKTYVITGGLGGFGLELAEWLLQRGAQKLVLTSRSGIRTGYQNKQV
TEWRSQGIQVLVSTRDASSLEGARALIAEASQLGPIGGIFNLAVVLRDAILENQTPEQFQ
DVNRPKYSGTLNLDRVTREACPELDYFVAFSSVSCGRGNMGQSNYGFANSTMERICEQRR
HDGLPGLAVQWGAIGDVGILLDLMGNSDTTVGGTLPQRIASCLEVLDLFLQQPYAVLSSF
VLAEKTATHRDSKVQPDLLQAIAHILGIHDLSRINLDTSLADLGLDSLMGVEVRQTLERE
YDMVLSMREVRQLTLQKLQKLSSSKSNPASELESPKAKEGNQTQPQGQLNLSTLLVNPEG
PTLTRLNSVQSTERPLFLVHPIEGSTTVFHSLAAKLSVPTYGLQCTQAAPLDSIQSLAAY
YIDCIKQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQEPAPAHNSLFLFDGSHTYVLAYT
QSYRAKMTPGCEAEAEAEAICFFVQQFTDAEHNRMLEALLPLKDLEERVAAAVDFITQSH
QNLNRRELSFAALSFYYKLRAIEQYTPRAKYHGNVTLLRAKTGGAYGEDLGADYNLSQVC
DGKVSVHIIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
Download sequence
Identical sequences ENSCPOP00000002086 ENSCPOP00000002086 10141.ENSCPOP00000002086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]