SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002250 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002250
Domain Number 1 Region: 238-341
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.58e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00054
Further Details:      
 
Domain Number 2 Region: 1-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000051
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 
Domain Number 3 Region: 83-149
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000013
Family Heme-binding PAS domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002250   Gene: ENSCPOG00000002470   Transcript: ENSCPOT00000002503
Sequence length 795
Comment pep:known_by_projection scaffold:cavPor3:scaffold_24:4517593:4568790:1 gene:ENSCPOG00000002470 transcript:ENSCPOT00000002503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICD
IQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSILYVSDSITPLLGHLPSDVMDQNLL
NFLPEQEHSEVYKMLSSPMLLNEAPSPEFLKSDNDLEFYCHLLRGSLNPKEFPTYEYIKF
VGNFRSYNNVPSPSCNGFDNTLSRPCRLPLGEEVCFIATVRLATPQFLKEMCIIDEPLEE
FTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLAKCHQHLMQFGKGK
SCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVLLERRQDLALEAEA
LHPSVLKDKDSSLDPQPHFNTLDTSTPGLNASPSPSVSSRSSHKSTNRAVSEPASTPTKL
MAEASTKAMPSSTTLPQEAPVPGLSQAATMPAPLSSPSSCDLGQQLLPQTILQSPPAPMA
QFSAQLSMFQTIKDQLEQRTRVLQANIRWQQEELHKIQEQLCLVQDSSVQMFLQQPAISL
SFSSAQRPEVAAVSQPQLVTSPQLPGQMAAAQVTSQHLLRESIVISSQGPKPMRSPQVVQ
GSSRLAASLPPPFGSTAALLPPALSLAAPVPTSQDASQPGPDFSHDRQLRLLLSQPIQPM
MPGSCDARPPAEASRTGQHVKFAPSQSVFPSLDSHPTSSSTTTPVLLMGQAVLHPSFPAS
QPGPQQQQPPPRYLQAQAPTSLHSEQPDSLLLSTYAQQPGTLSYAPPPAVQSQPTRPPRR
VSRVSEASGLQQPPR
Download sequence
Identical sequences ENSCPOP00000002250 10141.ENSCPOP00000002250 ENSCPOP00000002250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]