SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002259 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002259
Domain Number 1 Region: 91-393
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.06e-70
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002259   Gene: ENSCPOG00000002480   Transcript: ENSCPOT00000002513
Sequence length 438
Comment pep:known_by_projection scaffold:cavPor3:scaffold_52:12479444:12507252:-1 gene:ENSCPOG00000002480 transcript:ENSCPOT00000002513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPPDSQKTWAENPKGMLAVQSLSPHGVPWATVVTAVSHFRMSLPALRRDQLLASLDP
LALNKYSLPSVQHPTMPQALWGDQEPLSKIPLKILRGHEHIVSSCHFCVNDTKLLSGSYD
CTVKLWDPVDGTVIRDFEQRPKAPVLECSVTADSRRILAASYDKTVRAWDLETGQLLWKI
RYDTFVASCKFSPDGKYVVSGLDVDHGIYIMDAENLTTVKYIEGHHQRSIMACCFDPDSQ
KVASVSLDRCIKIWDVTSQATVLSIPRAHESGLSNCCFTFSGHFLCTASWDKSLKIWNVY
TGEFRNRGACVTLMQGHEGSVSSCCFARDSSFLISGGFDKTVAIWDVAEGYQKLSLKGHK
DWVMDVAISNDKKWILSASKDRTMRLWNIEDIDQIPLVIKYKKTMGLTMKQCERCSRPFS
IFESNSSSEILTKCVFCR
Download sequence
Identical sequences 10141.ENSCPOP00000002259 ENSCPOP00000002259 ENSCPOP00000002259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]