SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002297 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002297
Domain Number 1 Region: 5-434
Classification Level Classification E-value
Superfamily ALDH-like 7.72e-120
Family ALDH-like 0.000000000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002297   Gene: ENSCPOG00000002523   Transcript: ENSCPOT00000002557
Sequence length 466
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:8107559:8111488:-1 gene:ENSCPOG00000002523 transcript:ENSCPOT00000002557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDPFEDMVRRLRGAFNLGQTRPAAFRMAQLEGLGRFLRENKQLLHDGLFQDPQKSPFDSD
TSEIILCQNEVDLAIKNLQTWMKDKPADTNLLTKLDCAFTRKEPFGLVLIISPWNYPVNL
TLVPLVGAIAAGNCVILKPSEISKGTEKVLAEELPQYLDQNCFAVALGGPEETQKLLEHK
FDYIFFTGSSRVGKIIMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRLAWFRYFNT
GQTCVAPDYVLCSPETRERLVPALQNAITRFYGDDPQNSPNLGRIISEKHFKRLKGLLSC
GRVAIGGQSDENNLYIAPTVLVDVQETDKVMQEEIFGPILPLMTVSSLDEAIDFINRQEK
PLALYAFSNNSQVVKQVLDQTSSGNFGGNSGFLYMTLPGLPFGGVGKSGMGRYHGKFSFD
TFSNHRACLISPSGLEKLNEIRYPPYSSQAQKLLRWAMRSHSCTLL
Download sequence
Identical sequences ENSCPOP00000002297 10141.ENSCPOP00000002297 ENSCPOP00000002297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]