SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002300 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002300
Domain Number 1 Region: 28-255
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-28
Family FAD-linked reductases, N-terminal domain 0.081
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002300
Domain Number - Region: 567-616
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0597
Family Transferrin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002300   Gene: ENSCPOG00000002527   Transcript: ENSCPOT00000002561
Sequence length 682
Comment pep:known_by_projection scaffold:cavPor3:scaffold_28:21184818:21202490:-1 gene:ENSCPOG00000002527 transcript:ENSCPOT00000002561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPAALWGPLGLLSSLALHAALGAHPHRDYCVLGAGPAGLQMAAFLHRAGRDYEVFERA
PAPGSFFTRYPRHRKLISINKRYTGKTNAEFNLRHDWNSLLSPDPRLLFRHYSRAYFPDA
GDMVRYLRDFADRLGLHVQYNTNIVHVTLEKDRQAWNGHYFILTNQKGQLYRCSVLLVAS
GLSVPNQVDFPGSEYAEGYETVSVDPEDFVGQNVLILGRGNSAFETAENILGVTNFIHML
SRSRVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLESDLRDLAIVKDAKGKFHITLKF
FLEETNASQSADSIPLPQDNSDNFAMRVAYDRVIRCLGWNFDFSIFNQSLRLSSGGEFSK
KYPLIRASYESKGSRGLFILGTASHSLDYRKSAGGFIHGFRYTVRAVHRLLEHRHHGLAW
PHTAHPVSQLTDSIIRRVNEASGLYQMFGVLADVVLLKENATVFEYLEEFPMQMLAQLET
LTGRTAKHGLFVINMEYGRNFSGPDKDVFFHDRSVGHTEDAWQSNFLHPVIYYYRHLPTE
QEVRFRPAHWPLPRPTAIHHIVEDFLTDWTAPVGHILPLRRFLENCLDTDLRSFYAESCF
LFALTRQKLPPFCQQGYLQMQGLASTESLRKHGVESGLLPDYATTGQVLEDGSQQPGDRE
PGGHLPATGHLIQSLDSSKQEL
Download sequence
Identical sequences A0A286XWH4
ENSCPOP00000002300 XP_003470510.1.53824 ENSCPOP00000002300 10141.ENSCPOP00000002300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]