SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002592 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002592
Domain Number 1 Region: 26-487
Classification Level Classification E-value
Superfamily ALDH-like 1.26e-83
Family ALDH-like 0.00000556
Further Details:      
 
Domain Number 2 Region: 509-770
Classification Level Classification E-value
Superfamily ALDH-like 9.95e-43
Family ALDH-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002592   Gene: ENSCPOG00000002850   Transcript: ENSCPOT00000002886
Sequence length 804
Comment pep:known_by_projection scaffold:cavPor3:scaffold_70:8027338:8040376:-1 gene:ENSCPOG00000002850 transcript:ENSCPOT00000002886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASDAGPSVREIFSTLEYGPAPESHACALAWLDTQDRLLGHYVNGKWLKPEDRNSVPCQ
DPVTGENLASCLLAEPDDVAAAVKAALEVLGSWSRVPGAKRAQHLTRLAKMIQKHQRLLW
TLDSLVTGRAVREIRDRDVLLAQQLLQYQAVQAQVQEEALAGWKPMGVIGLILPPTFSFL
EMMWRICPALAVGCTVVAIVPSASPTPLLLAQLAGELGAFCGILNVIIGPASLGATLGLC
PGVQKVAFCGAVEEARVLRQSLAGQRLELSLALGTESLLLLMDSADLDSAVEGVVDAAWS
DRSPGGLRLLVQESVWEETFRRLQTRMGQLRCGRGLDGAVDMGTRGAAAHYVAQCYVQEA
QSQGAEVFQAIPVLSASPFYPPTLVSGLPPASPCAQAEVPWPLVVASSFRTAKEALAVAN
STPRGGSASVWSERLGQALELAYGLRVGTVWVNSHGLRDPAVPTGGCKESGSSWHGGLDG
LYEYLQPSGTPERLPFEYQDLNYDSFGLTVPVSLPAGPETGPSPVPPYGLFVGGRFQPPG
AWSSRPIWDSSGNLHGYVAEGGAKDVRGAVEAAHQAAAGWEHQPPGVRATLLVALAAALE
RRGAGLAERLQQHGADPEAAKTEVELSAGRLRLWAAYAQAQAQGHTLQVAGLKGPVLRLR
EPLGVLAIVCPDEWPLLAFVSLLAPALAHGNAVVLVPSRTCPLLALEVCQDVASMFPAGL
VNVVTGDCDHLTRCLALHQDVQALWYFGSAKGSQFVEWASAGNLKPVWVNRGHPRAWDQE
PQGTGSELALRAARTKALWLPMGD
Download sequence
Identical sequences H0UZI3
10141.ENSCPOP00000002592 XP_003465563.1.53824 ENSCPOP00000002592 ENSCPOP00000002592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]