SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002777 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002777
Domain Number 1 Region: 32-257
Classification Level Classification E-value
Superfamily Heme oxygenase-like 4.01e-73
Family Eukaryotic type heme oxygenase 0.000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002777   Gene: ENSCPOG00000003068   Transcript: ENSCPOT00000003109
Sequence length 316
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:24451961:24456346:1 gene:ENSCPOG00000003068 transcript:ENSCPOT00000003109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVETSEGVDELERKNPVAPEKENHIRMPDLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMDRNKDHSAFAPLYFPMELHRKEALTKDMAYFFGEN
WEEQVMCSQATQKYVERIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYQFENVDNAQQFKQFYRARMNALDLSLKTKERIVEEANKAFEYNMQIFDELDQA
GSMLARDTLEDGFPVHDGKGDIRKCPFYTAQQDKGALEGNSCPFRTAISVLRKPSLQLIL
ATSVALAAGLLAWYYI
Download sequence
Identical sequences H0UZZ9
10141.ENSCPOP00000002777 XP_003477769.1.53824 XP_005007527.1.53824 ENSCPOP00000002777 ENSCPOP00000002777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]