SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002791 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002791
Domain Number 1 Region: 508-694
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-42
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 216-318,350-404,443-505
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.98e-42
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-19
Family Flavin-binding PAS domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002791   Gene: ENSCPOG00000003081   Transcript: ENSCPOT00000003124
Sequence length 989
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:15288462:15683234:-1 gene:ENSCPOG00000003081 transcript:ENSCPOT00000003124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEV
MQKSSTCSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQ
DKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHK
HSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVS
FKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDL
LSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLFSSLKVVRLLR
LGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLY
QLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFA
VAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYI
VSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTV
HCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCAN
VRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
MKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGSVLPEHSANNH
SLGKASVVTVRESPATPVSFQAASASTVSDHAKLHAPGSECLGPKGAGGDCAKRKGWARF
KDACGKGEDWNKVSKAESMETLPERTKAAGEATLKKTDSCDSGITKSDLRLDNVGEARSP
QDRSPILAEVKHSFYPIPEQTLQATVLEVKHELKEDIKALNAKMASIENQLSEILRILTA
RRSSQSPQELFEISGPQSPESERDIFGAS
Download sequence
Identical sequences H0V012
ENSCPOP00000002791 XP_003474386.1.53824 ENSCPOP00000002791 10141.ENSCPOP00000002791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]