SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002853 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002853
Domain Number 1 Region: 8-485
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-184
Family ALDH-like 0.0000000000000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002853   Gene: ENSCPOG00000003149   Transcript: ENSCPOT00000003192
Sequence length 490
Comment pep:known_by_projection scaffold:cavPor3:scaffold_155:1559123:1600927:-1 gene:ENSCPOG00000003149 transcript:ENSCPOT00000003192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQTPSCCLLFQIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVRAARLAF
SLGSTWRRMDASERGRLLDKLADLVERDRAILATMESLNGGKPFLQAFYVDLQGVIKTLR
YYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVV
IKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIAAHAGIDKIAFTGSTEVG
KLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDHAVEQAHQGVFFNQGQCCTAGSRIFV
EESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNRILELIQSGVAEGAKLECG
GKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIQRANSSDFGLVAA
VFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGELGLREYSEVKT
VTVKIPQKNS
Download sequence
Identical sequences 10141.ENSCPOP00000002853 ENSCPOP00000002853 ENSCPOP00000002853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]