SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002859 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002859
Domain Number 1 Region: 237-355
Classification Level Classification E-value
Superfamily ApaG-like 1.44e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 76-143,170-200
Classification Level Classification E-value
Superfamily YccV-like 0.00000000000562
Family YccV-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002859   Gene: ENSCPOG00000003155   Transcript: ENSCPOT00000003198
Sequence length 368
Comment pep:known_by_projection scaffold:cavPor3:scaffold_32:24094582:24102535:1 gene:ENSCPOG00000003155 transcript:ENSCPOT00000003198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACVARRALAVGSRWWSRPLTAARGSRPLCAAGGAPAFPSATTTTAQRHLSSRNRAEGK
VLETVGVFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAASEKTENPAG
HGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHED
ILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTEN
IRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRG
VVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEK
TPPSGLHW
Download sequence
Identical sequences H0V076
ENSCPOP00000002859 ENSCPOP00000002859 10141.ENSCPOP00000002859 XP_003469786.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]