SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002908 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002908
Domain Number 1 Region: 34-237
Classification Level Classification E-value
Superfamily DNA-glycosylase 6.28e-59
Family Endonuclease III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002908   Gene: ENSCPOG00000003211   Transcript: ENSCPOT00000003254
Sequence length 239
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:22138292:22143108:-1 gene:ENSCPOG00000003211 transcript:ENSCPOT00000003254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGEKSEGADLPVVTVWEPQEWQQQLTNIRIMRSKKDAPVDHLGAEHCCDPSAPPKVQRYQ
ILLALMLSSQTKDQVTAGAMQRLLAQGLTVDSILQTDDNTLGKLIYPVGFWRSKVKFIKQ
TSAILKQRYNGDIPASLAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLKW
TKRMTKSPEETRAALEEWLPRQLWSEINGLLVGFGQQICLPTHPRCQTCLNQALCPSAQ
Download sequence
Identical sequences ENSCPOP00000002908 ENSCPOP00000002908 10141.ENSCPOP00000002908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]