SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002920 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002920
Domain Number 1 Region: 34-146
Classification Level Classification E-value
Superfamily FKBP-like 1.1e-35
Family FKBP immunophilin/proline isomerase 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002920   Gene: ENSCPOG00000003224   Transcript: ENSCPOT00000003267
Sequence length 200
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:50651687:50655232:1 gene:ENSCPOG00000003224 transcript:ENSCPOT00000003267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILCPSLSPLHLLLLLLSGALCRAEAGSETESPIRTLQVETLVEPPEPCAETAAFGDTLH
IHYTGSLVDGRIIDTSLSRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAVIPSHLAYGK
RGLPPSIPADAVVQYDVELIALIRANYWQKLVKGVLPLVGMAMVPALLGLIGYHLYRKAS
QPKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences A0A286XC55
10141.ENSCPOP00000002920 ENSCPOP00000002920 XP_003475867.1.53824 ENSCPOP00000002920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]