SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002937 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002937
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily FKBP-like 5.5e-42
Family FKBP immunophilin/proline isomerase 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002937   Gene: ENSCPOG00000003243   Transcript: ENSCPOT00000003286
Sequence length 108
Comment pep:novel scaffold:cavPor3:scaffold_8:3310520:3329214:-1 gene:ENSCPOG00000003243 transcript:ENSCPOT00000003286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGAKGHPGIIPPHATLVFDVELLKLE
Download sequence
Identical sequences A0A286XID4
10141.ENSCPOP00000002937 XP_003476394.1.53824 ENSCPOP00000002937 ENSCPOP00000002937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]