SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000002978 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000002978
Domain Number 1 Region: 156-251
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.14e-21
Family Middle domain of MutM-like DNA repair proteins 0.022
Further Details:      
 
Domain Number 2 Region: 63-133
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000262
Family N-terminal domain of MutM-like DNA repair proteins 0.013
Further Details:      
 
Domain Number 3 Region: 319-346
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000863
Family Ran binding protein zinc finger-like 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000002978
Domain Number - Region: 245-283
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0228
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000002978   Gene: ENSCPOG00000003297   Transcript: ENSCPOT00000003340
Sequence length 607
Comment pep:known_by_projection scaffold:cavPor3:scaffold_36:16009958:16053713:-1 gene:ENSCPOG00000003297 transcript:ENSCPOT00000003340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTVNGEKIRARVLPGQAVTDVRGRALQSPQGPGSSLAAPVAEVSFQAAAMKDSN
DSSQNFLRLLNGYLYSGVETLGKELFMFFGPKALRIHFGMKGSIMINLLPCKNKNGDSSV
FELQLTNDLICFFDSSVELRNSVEIQQRIRMMRELDVCSPKFSFLGAESEVKKQRDRMLC
DVLLDQKVLPGVGNIIKNEALFDSGLHPALKVFQLTDEQIHHLVKMVRDFSILFYRCCKT
GSAISKHYKVYKRPNCGQCHCKITVCRLGENNRMTYFCPHCQKENPQHTDICKLPTRNTI
INWRPSSGDHLTDSVGRKSEEQWTCLVCTLINKPSAETCDACFTSKPVDSVFKNEENSIV
FHNLVKYPCNTFRKAHAEVKINRKTAFGTTTLVLTDFSNKSNTLKRKESQTQTPDGEFQN
SLPANVCFSDTRHPSKERTNYITQVSNKVNTSPTVCSQSELFSSAHKKLKTTHYSTPDLK
SCNTGFSNSQLQASMTDGPCTSNAGGPRCRKHNRLCVLRVVRKHGENRGRQFYACPLPGD
AQCGFFEWADLSFPFCSHGKRSIMRTVLKIGPNNGRNFFVCPLEKEKQCNFFQWAENGPG
IKIIPGC
Download sequence
Identical sequences H0V0I9
ENSCPOP00000002978 ENSCPOP00000002978 10141.ENSCPOP00000002978 XP_003469165.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]