SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003046 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003046
Domain Number 1 Region: 309-366
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.33e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000549
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003046
Domain Number - Region: 272-315
Classification Level Classification E-value
Superfamily ARM repeat 0.0104
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003046   Gene: ENSCPOG00000003370   Transcript: ENSCPOT00000003413
Sequence length 366
Comment pep:known_by_projection scaffold:cavPor3:scaffold_20:24728275:24759940:-1 gene:ENSCPOG00000003370 transcript:ENSCPOT00000003413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWESKLMQSRAVDGFHSEEQQLLLQV
QQQHQPQQQQHHHHHHHQQAQPQQTAPQQAQTQQVLIPASQQAAAPQVIVPDSKLIQHMN
ASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIP
QMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQI
TAAGQQQPQAQPTQQQAPLVLQVDGTGDTSSEEDEEEEEDYDDDEEEEKEKDGAEDGQVE
EEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKA
IGDAEW
Download sequence
Identical sequences A0A286XL94
ENSCPOP00000003046 ENSCPOP00000003046 10141.ENSCPOP00000003046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]