SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003047 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003047
Domain Number 1 Region: 2172-2266
Classification Level Classification E-value
Superfamily C-type lectin-like 8e-31
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 967-1124
Classification Level Classification E-value
Superfamily FAS1 domain 1.18e-28
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 3 Region: 1569-1719
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-28
Family FAS1 domain 0.00082
Further Details:      
 
Domain Number 4 Region: 521-649
Classification Level Classification E-value
Superfamily FAS1 domain 1.31e-24
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 5 Region: 1131-1258
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-20
Family FAS1 domain 0.0035
Further Details:      
 
Domain Number 6 Region: 2262-2423
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-17
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 7 Region: 331-497
Classification Level Classification E-value
Superfamily FAS1 domain 6.28e-17
Family FAS1 domain 0.0025
Further Details:      
 
Domain Number 8 Region: 1467-1506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000796
Family Merozoite surface protein 1 (MSP-1) 0.052
Further Details:      
 
Domain Number 9 Region: 1509-1547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-like domain of nidogen-1 0.064
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003047
Domain Number - Region: 2109-2142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000275
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 1935-1984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000435
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 228-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00054
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 191-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000658
Family Merozoite surface protein 1 (MSP-1) 0.063
Further Details:      
 
Domain Number - Region: 2063-2100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 807-953
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00141
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 1982-2102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00204
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 1378-1506
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00235
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 1338-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0172
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 102-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0981
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003047   Gene: ENSCPOG00000003371   Transcript: ENSCPOT00000003414
Sequence length 2501
Comment pep:known_by_projection scaffold:cavPor3:scaffold_283:297717:433829:-1 gene:ENSCPOG00000003371 transcript:ENSCPOT00000003414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLRCARVILLGLFLQKSCSLAAAPEQGNRCDKKIVLTVTTPCQPCTVRLPCLNGFTSAG
VQDCRYSLYYLSLSVFEPGCRQVCQKNQSQPECCPGHWGPDCMECPGGAKSPCSGRGNCS
EGIEGNGSCSCLEGFSGTACETCTQDNVFGPNCTSVCKCVHGLCNSGLQGDGTCECYTGY
TGPNCDTPVPECASLLCPENSRCSPQSEDRTKLECRCLPGYRANGKDCDPINPCLHLPCG
PHARCNYLGPNQHSCMCGEGYLGDGLVCLPEDPCQADFGKCPPESTVCKYDGPGKSHCEC
QEHFHSFLPGVGCSMTDLCKTKNPCHGNANCTMAAPGQTQCICPQGYVSNGFTCYGNIME
RLQELDTVPRGTWQGKLTTFISLLDKAYAWPLSSLGPFTLLLPSSEKEPKEFNVEELLRD
PEAARHFAKLHIIAGQMSMEQMNNSDTFYTLSGVPGRISNRDKDNQIKLELHGGKKKVKI
IEGNILASNGLIHILDAAMDNIKPTLESDSKQTIAKLIPERCSRFRALLQATNLASTLDK
DGDNGPYTVFVPSNEALLSMKTDDLRYLLSPEGSKKLLELVRYHIVPSTQLEVATLVSTR
QIRTMANQIIRFNVTANGRILANDVAMEDIEVTAKNGRMYTLGGVLIPPSILPILPQRCD
ETQSETVQGSCVSCAVVFHSSCPVNAVPMPQTVSHCTISTVFGNIQGCVQRCKITVKIPK
CCKGFCGPDCIPCQGALLNSCPPNRQYVKDINGNGTCVCKDGFYGSQCEFCSDRKSYGPQ
CDQKCHCVLGTCDNRVDSTGACQPRSCRPGIHGKFCDTRFLFCGPFRLHICSIYAQCRPD
SLTLGCVCRPGYEGNGVVCSEKDPCANPSRGGCSQNAKCVKTGPPQGHLCICQPGWTGNG
RECVEINPCLLPSKGGCHSNATCLYVGPGQRECECQKGFRGDGIDCQPITCLEQSGMCHP
MATCQVAASGEWSCVCQEGYKGDGFLCYGNVAVELSLLPEAAAFNQWVKNALLQPVLSAS
SNLTILAPSQQAVEDMNPDEKNFWLSESNIPALIKHHTLPGSYSVEDLQSLPSPGTLATS
LQGSVLPLQKVDGNVTLGGAAIINGDNMATNGVIHIISKVLLPERSLSGSLPNLLTRLDQ
MPDYSAFRGYILHYNLASVIEAADAYTVFAPNNDAIKSYIREKKVSSLEEDTIRYHVVLE
KLLKNDLRHGLHRETLLGPSYMLGFFLRGNQLYVNEAPINYTNAATDKGVIHGLEKVLEI
QKNRCDNNETITIQGKCEHCQKPPICPPGTKPLQEKRSPCVSSFYFMGKRSVFIGCRPTC
TRTVITRSCCAGFFGPQCQACPGQLGSTCFGNGICMDGVNGTGMCACDPGFQGTACETCV
DGKYGIHCDQACTCVHGRCNQGPSGDGSCDCDVGWRGVSCDSAITEDHCNGTCHTSANCL
LSPDGNASCSCAAGFQGNGTVCKAINPCETRNGGCAPEAYCKRTTPGSRVCECKADYTGD
GIVCLEINPCLENNGGCDRNAECTHTGPNQAVCNCLPNYSGNGKVCTRISLCLIGNGGCH
SNAVCSDTKTGKRTCTCKQNYVGNGFTCRGHIYEELPKDPQTSQYFFQLQEHKIRDLVGE
GPFTVFAPLSAAFDREPRIKDWDRLGLMSQVLRYHIVACQQLLLENMKLTPNVTSLQGEQ
IVISVSQDAVSINNKAKVIASDIMNRNGVVHIIDTLLSPQNLLVTPRDASGRVLEKVNRG
KIHVKSMCALTGLCVSFVDGSALPWPGQSAWMPSSEARRFARLMVPKVPVRGAGSLEVDS
RFWPHFPSAYWVLEVLDTSCGLKRTQGQLFLNDQKCRIVQRELLFDLGVAYGIDCLLIEH
SLGGHCTVFSTYDVMGDCGNCLSTPKCPAWSKPKGVTQTCTYRRINHARSLQGCRNECVM
TLTLPKCCKGYFQPDCQACPGGPDTPCNNRGTCLEMLSLDGQCLCNPGFNGTACELCLPR
HFGPDCQPCNCSAHGQCDDGISGSGQCLCDSGWTGSSCDTHTAVVPVCKPPCSVHAVCRE
NNTCECGLHYEGDGITCTAVDFCKQNNGGCAKVAQCSQKNTTVSCSCPNGYQGDGYSCVK
IDPCADGLNGGCHEHATCKMTGPGKRKCKCKSHYVGDGLDCEPEQLPLDRGLQSTAGTAK
LTTRHFPDTTVGVFHVRSPLGQYKLTFDTARATCASEAATVATYNQLSYAQKAGYHLCSA
GWLDSGHVAYPTAYSSRKCGGGAVGIVDYGVRTNKSEVWDVFCYRMKDVNCTCKAGYVGD
GTSCSGNLLQVLMSSSTLNVFLTEVLAYSNSSARGRAFLRRLTNLSVPSTLFVPLNIELG
ENETLTGRDIEHHLANASAVYYEDLVNGTVLWTPLGSPLLITTSREELSLNETRFVDGRA
IVLWDMFAANGVIHVISRPLKAPPAPVTSAHAGMGTGIFSAIILITGAVALAAYSYFRLN
RRAIGFQRFESEEDINVAALGKQRPENISNPMYEESRSSAP
Download sequence
Identical sequences ENSCPOP00000003047 ENSCPOP00000003047 10141.ENSCPOP00000003047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]