SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003304 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003304
Domain Number 1 Region: 393-741
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.95e-91
Family YicI catalytic domain-like 0.0000615
Further Details:      
 
Domain Number 2 Region: 743-825
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.37e-21
Family Putative glucosidase YicI, domain 3 0.0066
Further Details:      
 
Domain Number 3 Region: 88-177,261-390
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000879
Family YicI N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003304   Gene: ENSCPOG00000003659   Transcript: ENSCPOT00000003703
Sequence length 963
Comment pep:known_by_projection scaffold:cavPor3:scaffold_44:15113011:15125832:1 gene:ENSCPOG00000003659 transcript:ENSCPOT00000003703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVEVVARRRRYRMGLMLVFLGLFMGNALAVDRSNFKTCDESSFCKRQRSLRPGLSPY
RALLDSLQLGPDGLTVQLVHEVTKVVLVLELQGLQKNMTRFRLDELQPLHPRYRVSDVLV
ADPAPARLSVSGRDDNSVELTVAEGPYKIILTAKPFRLDLLEGRSLLLSVNARGLLEFEH
QRHRRVPFSDKVSLTLGSMWDKIKNIFSRQGARDPAEVDGAQPEAAAGDGDKPEEPTERE
EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYGIPEHADSLRLKVTEGGEPYRLYN
LDVFQYELDNPMALYGSVPVLLAHSPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMLDY
LQGSGETPQTDVRWMSESGIIDVFLLLGPSVFDVFRQYTSLTGTQALPPLFSLGYHQSRW
NYRDEADVLQVDQGFDDHNFPCDVIWLDIEHADGKRYFTWDPSRFPQPHSMLQHLASKRR
KLVAIVDPHIKVDSGYRVHEELRNQGLYVKTRDGSDYEGWCWPGSAGYPDFINPATRAWW
ASMFSFDNYEGSAPNLFIWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGFYVHM
ATAEGLIQRSGGVERPFVLSRAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSMGLVGL
SFCGADVGGFFKNPDPELLVRWYQMGAFQPFFRAHAHLDTVRREPWLLPAQHQEVIREAL
GQRYSLLPYWYTLFYRAHIEGVPVMRPLWVQYPQDVTTFSIDDQFLLGDALLVHPVSDAG
AHGVQVYLPGSGEVWYNIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTVVPRWMRVRRSSD
CMKDDPITLFVALSPQGMAQGELFLDDGHSFNYQTRQEFLLRRFSFSQNTLVSSSADLRG
HFETPVWIERVVIMGAEKPATVVLQVPGSPESHLSFQHNTETSTLVVRKPGVSVASDWSI
QLR
Download sequence
Identical sequences H0V1E2
10141.ENSCPOP00000003304 ENSCPOP00000003304 ENSCPOP00000003304 XP_003467969.2.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]