SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003523 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003523
Domain Number 1 Region: 20-113,156-173
Classification Level Classification E-value
Superfamily FKBP-like 1.45e-28
Family FKBP immunophilin/proline isomerase 0.00054
Further Details:      
 
Domain Number 2 Region: 137-240
Classification Level Classification E-value
Superfamily EF-hand 0.00000000178
Family Calbindin D9K 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003523   Gene: ENSCPOG00000003904   Transcript: ENSCPOT00000003948
Sequence length 247
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:12047816:12059494:1 gene:ENSCPOG00000003904 transcript:ENSCPOT00000003948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFGLCGCYIAQEQKNEESTEVKIEVLYRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYC
SRTQNEGHPKWFVLGVGQVIKGLDIAMMHMCPGEKRKVTIPPSFAYGKQGYVILEEVCPL
QHVLASCHRAPLHVLKCMRLFSAFINHTCAEGKIPPDATLIFEIELYAVTKGPRSVETFK
QIDADNDRQLSKTEVSYYLEREFEKDEKPRDKSYQNAVLEDFFKKNDHDGNGFISPKEYN
VYQHDEL
Download sequence
Identical sequences ENSCPOP00000003523 ENSCPOP00000003523 10141.ENSCPOP00000003523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]