SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003857 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003857
Domain Number 1 Region: 445-584,701-861
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 7.59e-115
Family Substrate-binding domain of HMG-CoA reductase 0.000000000103
Further Details:      
 
Domain Number 2 Region: 587-703
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 6.54e-45
Family NAD-binding domain of HMG-CoA reductase 0.000000478
Further Details:      
 
Domain Number 3 Region: 45-219
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0000641
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003857   Gene: ENSCPOG00000004276   Transcript: ENSCPOT00000004321
Sequence length 888
Comment pep:known_by_projection scaffold:cavPor3:scaffold_212:389454:403497:-1 gene:ENSCPOG00000004276 transcript:ENSCPOT00000004321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGDNKVCGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTAEHPKVSLGLDENAPKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQAETESTLSLKNPITSPGVA
QKKVPDSCCRREPVLVRNNQKLQSVEEETGINQERKVEVIKPLVADTDTSNRATFVLGTS
CLPDPPSDLVTQEPEIQLPREPRPAEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLAEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV
AGPLSLDGKEFQVPMATTEGCLVASTNRGCRAISLGGGASSRVLADGMTRGPVVRLPRAC
DSAEVKAWLETPEGFAVIKEAFDSTSRFARLQKLHTSMAGRNLYIRFQSKTGDAMGMNMI
SKGTEKALSKLHEYFPEMQVLAVSGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREV
LKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL
MEASGPTNEDLYISCTMPSLEIGTVGGGTNLLPQQACLQMLGVQGACVDNPGENARQLAR
IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGTCTKKAS
Download sequence
Identical sequences H0V2S7
10141.ENSCPOP00000003857 ENSCPOP00000003857 ENSCPOP00000003857 XP_003461384.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]