SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003872 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003872
Domain Number 1 Region: 78-188
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.1e-36
Family Frataxin-like 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003872   Gene: ENSCPOG00000004293   Transcript: ENSCPOT00000004338
Sequence length 201
Comment pep:known_by_projection scaffold:cavPor3:scaffold_21:20303356:20325346:1 gene:ENSCPOG00000004293 transcript:ENSCPOT00000004338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRAAAGLLPRTTSPSPAQARNRRTAVAAQVCGKNKGKTFHSSLTLYYLRQILNGK
KQSVHLMHLRNSGTLGNTGTLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGS
GVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKSWVYSHDGMSLHELLAME
LTKVLKTELDLSSLAYSGKGT
Download sequence
Identical sequences ENSCPOP00000003872 10141.ENSCPOP00000003872 ENSCPOP00000003872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]