SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004394 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004394
Domain Number 1 Region: 5-352
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 6.54e-72
Family ADP-ribosylglycohydrolase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004394   Gene: ENSCPOG00000004882   Transcript: ENSCPOT00000004935
Sequence length 362
Comment pep:known_by_projection scaffold:cavPor3:scaffold_35:21024170:21028089:1 gene:ENSCPOG00000004882 transcript:ENSCPOT00000004935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGGLMERYVAAMLLSAAGDALGFFNRKWEFLRDGEKIHQQLAELGGLDAIDVKQWRVSD
DTVMHLATAEALLQAGKAPSLARLYSLFAKHYQDCMEDMAGRAPGDTSVHNSMRLEPDKA
NGWRIPFNTHEGGCGAAMRAMCIGLRFPHLSQLDTLIHVSIESGRMTHHHPTGYLGALAS
ALFTAYAVNGRPPWEWGKGLMEVLPAAKDYIVQSGYFVEENLEHWSYFQDQWEKYLKLRG
ILDGKSAPVFPQAFDVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAILAAGDSWKKLAHH
AFFHGGDSDSTAAIAGCWWGAMHGFKGVSPSNYEKLEYRERLEKAARALYSLGSNEDAVI
SL
Download sequence
Identical sequences A0A286Y1N4
ENSCPOP00000004394 10141.ENSCPOP00000004394 ENSCPOP00000004394 XP_003469268.1.53824 XP_013007289.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]