SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004428 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004428
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.67e-63
Family Alanine racemase-like, N-terminal domain 0.0000000435
Further Details:      
 
Domain Number 2 Region: 249-417
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.61e-31
Family Eukaryotic ODC-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004428   Gene: ENSCPOG00000004919   Transcript: ENSCPOT00000004972
Sequence length 460
Comment pep:known_by_projection scaffold:cavPor3:scaffold_25:4279421:4303807:-1 gene:ENSCPOG00000004919 transcript:ENSCPOT00000004972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLEELTLGAPRAATGEVAAFFVADLGAIVRKHFCFLKCL
PRVRPFYAVKCNNSLGVLKVLAELGLGFSCVNKAEMELVQRIGVPASRIIYANPCKQIAQ
IKYAAKHGVQLLSFDNEVELAKVVKSYPSAKMVLCIATDDTHSLSRLSLKFGALLKSCRH
LLENAKKSHMEVVGVSFHVGSGCPDPQVYAQSIAEARLVFEIGAELGHTMHILDIGGGFP
GVEGTKVRFEEITSVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKKEVLLE
QPSREEENGSVLKTFVYHLDDGVYGIFNSVLFDNIWPTPILQKKPTTEQPLYSSSLWGPA
ADGRDCVAEGLRLPQLHIGDWLVFENMGAYTVGTGSLLGGTQTCHITYTMSRVAWEALRG
QLLPVEQDEDAEGVCKPLSCGWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences H0V493
NP_001280637.1.53824 XP_013009219.1.53824 ENSCPOP00000004428 ENSCPOP00000004428 10141.ENSCPOP00000004428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]