SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004474 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004474
Domain Number 1 Region: 435-570
Classification Level Classification E-value
Superfamily DNA-glycosylase 7.85e-35
Family Mismatch glycosylase 0.000000221
Further Details:      
 
Domain Number 2 Region: 59-179
Classification Level Classification E-value
Superfamily DNA-binding domain 3.92e-28
Family Methyl-CpG-binding domain, MBD 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004474   Gene: ENSCPOG00000004970   Transcript: ENSCPOT00000005024
Sequence length 576
Comment pep:known_by_projection scaffold:cavPor3:scaffold_109:2784646:2792946:-1 gene:ENSCPOG00000004970 transcript:ENSCPOT00000005024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGTTGLVPRSQGIALWVTYSGSLQPGAPRKRIVRRIMLLQDLMKVIDTVTQVMTNGSREC
NALLQGPIASPQCAGAAVTERHKPVLYGWERIVKQRLSGKTAGRFDVYFISPQGLKFRSK
SSVANYLLKNGDTALQPEDFDFSVRSERNIKSRCKGSTMAALTTQQQNKSNISNWNIRTR
SRQKTDVSPLPNSTLELQDSRGLSNLDSNHVLLREEENINDISSGKVRKFKGKVTALKGI
QNKRNRKQCSNSLPDAVQSNTKRESVFNKAEATSASVAQENQLDRAFCFSDGTTTHSTFG
VTEEEKSHVKEKSLSSGSEFYFEQITSGITNKSCPTTEGEHEKYEETFLESEEIRAKVED
GERKEHLHTDILQCDSEGDSSCSQSSKDLTSEKIYPEDSIPRTHTEKRKTSQYFSSKYNR
GALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEK
YPSAEVARAADWRDVSELLKPLGLYELRAKTIVKFSDEYLTKHWKYPIELHGIGKYGNDS
YRIFCVNEWKQVHPQDHKLNKYHDWLWENYEKLSLS
Download sequence
Identical sequences 10141.ENSCPOP00000004474 ENSCPOP00000004474 ENSCPOP00000004474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]