SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004483 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004483
Domain Number 1 Region: 5-454
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 1.01e-117
Family 2-methylcitrate dehydratase PrpD 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004483   Gene: ENSCPOG00000004981   Transcript: ENSCPOT00000005035
Sequence length 470
Comment pep:known_by_projection scaffold:cavPor3:scaffold_5:44761520:44767348:-1 gene:ENSCPOG00000004981 transcript:ENSCPOT00000005035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLKSVTESFANIIHGLKVGHLTDRVIQRSKRMILDTLGVGFLGTSTEVFHKVSQYSKIY
NSNTSSTVWGQQDFKLPPSYAAFVNGVAIHSMDFDDTWHPATHPSGAILPALTALSEALP
QSAKFSGLDLLLAFNVGIEVQGRLMHFSKEASDIPKRFHPPSVVGTLGSAAAASKLLGLS
LAECQQALAIAASFSGAPMANAATQTKPLHIGNAARHGTEAAFLAMLGLQGNKRILDLAT
GFGAFYTNYSPKVLPSLDSHSWLLDEQDVAFKRFPAHLATHWVAEAAASVRQHLVLSDGT
LLPADHIGKIVLRVPEVQYVNRPFPDSEHEARHSFQYVACTVLLDGDITVQSFHKDQVSR
PQVTELLKKVKLEHPSDNLPNFDTLYCDVSVTLKNGATFTEHCSTFYGHWRNPLNQEDLK
KKFRANATRVLPPNKLESLIKTVEKLEDLEDCSALTTLLNGSEEISISSS
Download sequence
Identical sequences ENSCPOP00000004483 10141.ENSCPOP00000004483 ENSCPOP00000004483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]