SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004562 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004562
Domain Number 1 Region: 15-134
Classification Level Classification E-value
Superfamily FKBP-like 1.26e-32
Family FKBP immunophilin/proline isomerase 0.00017
Further Details:      
 
Domain Number 2 Region: 111-206
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000157
Family Calbindin D9K 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004562   Gene: ENSCPOG00000005072   Transcript: ENSCPOT00000005127
Sequence length 211
Comment pep:known_by_projection scaffold:cavPor3:scaffold_44:6364614:6383784:-1 gene:ENSCPOG00000005072 transcript:ENSCPOT00000005127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLWNSILTLLIMSLSGALIPEPEVKIEVLHKPFICHRKTKRGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDRGLKEMCVGEKRKLIIPPALAYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLDDDWRLSKYEVKMYLKKEFEKHGAIVNESHH
DVLVEDIFDKEDEDKDGFISAREFTYLHDEL
Download sequence
Identical sequences A0A286Y4X1
ENSCPOP00000004562 10141.ENSCPOP00000004562 ENSCPOP00000004562 XP_003467905.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]