SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004635 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004635
Domain Number 1 Region: 2373-2562
Classification Level Classification E-value
Superfamily BRCA2 helical domain 3.4e-83
Family BRCA2 helical domain 0.0000000324
Further Details:      
 
Domain Number 2 Region: 2941-3073
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.23e-52
Family Single strand DNA-binding domain, SSB 0.00000634
Further Details:      
 
Domain Number 3 Region: 2724-2860
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.03e-51
Family BRCA2 tower domain 0.0000032
Further Details:      
 
Domain Number 4 Region: 2563-2693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-41
Family Single strand DNA-binding domain, SSB 0.00000127
Further Details:      
 
Domain Number 5 Region: 2695-2724,2861-2940
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-28
Family Single strand DNA-binding domain, SSB 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004635   Gene: ENSCPOG00000005153   Transcript: ENSCPOT00000005208
Sequence length 3313
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:33778275:33853154:1 gene:ENSCPOG00000005153 transcript:ENSCPOT00000005208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIGSKERPTFFEIFKRRCDKADLGPISLNWFEELSSEAPPFNSEPAEESEYKVNTYEPN
PFKTPQRKPCYQLASTPIIFKEQGQTLPLYQSPLNELGTDIADTELKNCHTVKANVDRIS
DVTSPPLNSCFSESPLVLRCTQKTPQRKMPVICGSLFHTPRLVKGQTPKHIPESLGAEVD
PDMSWSSSLATPPTLGSTVLLVRDEVSETIFPNDTTVILKHSLSSHDENLKKNDSFIPPV
MENENKNQREASHSGLGEVVGNSFGKTCSSKDHFGKLMPNPLENEVHETVTDIFDEDSFS
LCFPKYRTGNLQKTSKTRKKIFHEARTDDFKEQMKENKHSLTSEMEPNDGDPLDSDVASQ
KPLGPESDRISKEAAPSSSCEWSQLTFPGPNATQRKEMPVLPVSSYDQDNSGKDSIESEK
ESSNHNTSENSLPHTSSLSEKISNGEKPVDERDGRQHPESHEDSIRAVKGTVSWTSPVSP
LFQGAKRPIFKIGEPSEDTFNTVLSDIVMKPNFKETETSKSGLEMYTDCSQKEDSLCLSS
VDNRSLPAAIPHSSVTLKNTGLISSLKKKTKKFIYAINDKACYQRENLQENQKTELTSHS
AQFEADTFKASLTFTNADAGLSHSSVKRNCFQNDPKESTFLTNSSGTSPRKHSNNESSYA
NKIISQDLNYNETKLNKEKSQSLTSPETDFLSCLQKRRWDDDPKSQKVSDIKENVLVVTC
QPEARHSEAEHSGILFQSQKSFFDGHDNTSPLTLTPSSKDPLLNPVMISKGKKSYKISEK
LKRENCETGIELAQNISIENNQEICVLNLNSKKTELLPPEKYVSAASPSVTMPFSHNTNL
TATQEDQEETSLISEMPGNPNSEELFAGNKNNFVFQITDESSPVLGKTKEVHGSDCSFMK
ESILQNSAMVVDTDIDDKQVVQMPITEDFGPSNTIHDLKENRTDVKQHLASGQDLKSDLS
LDRKPNRNDYTHKMTVILGPVSSHSFGGGFRTASNKEIKVSQHYIKKGKMLFKDIEEQYP
TSSAPVEIVNALLNNEKKLNKPHAFDLQSVNTVSTYVQRSASISDHENHTASQRLSVKQD
FNSNLNLTPSQKAEITELSSILEESGSQFEFTQLRKPNHLIKSNTLQVPGNQMTALSTTS
KESKDVNLQAIIDASSICQVGSSKKFGGAAGEKQKSACLLKNNPNKSAAGFLTNENEVAY
RGFYSGLGTKKLSVSSEAPQKPLKLFSDIENISEETSDKVDPSFSASKCYDSVASVFKIE
NHNNNKNVNVKNSCQAVLQSNAEMTTGNFAEENTENCMRNSENEDNKYIGTSTNNCKLGK
PGGTDSSKNDTGYIQKDNDLPCKDQHNMHLKLSSQFMSEVSTELKETLSDLTCLEVVKAE
ETCYINSNEQLTTDEMEQYTNNFGISFQTASGKNISVTKESLNKAVNLFDQETEEWNDFS
DSLNCKLLPGIKNKMDISSHEETNVMKNKILEKSTPAGTAAQLCVLQQPECKIENEPNLL
GFYTASGKKVNIAKESLNKVKNLFDENRQDVSKITKWGHQVAKILSDRQDCEERLELARE
TVAITDIPQCEEMPSVSGGLHRQTKNLKASNSISLKVKVPENVEKGIANPPTTSCTDQFS
YSAIKDLPVAFYTGHGKKIPVNPALLFKATKWLKDLNDEHEEDCVGNPSRYLSKNQVDSG
TELVMNVKDKNNTDFSEVVPTIKVSTHPQAINEDVCVQQPVTISSPFKSKNPAVNVAVSD
SGNYEVGPPAFSTASSKMVFVSQDSTEKQVFIENCNKTINQNTESKSDTCQRETVTGSKA
LDNSEDAIFPDSPDDEECVRSCKSFADTQSEESLQHNKSMSGLETIFERPSYVSLKAPDK
CKFSDTEKLPKTMSSNIYGIFSTASGKSVQVSNGSLQKAKQMFSKTEDSAKQLFSKVFKS
SEHSDQFTKEEITVMRTPSKHSARSTAFSGFSTASGKQVSVSESALHKVKGMLEEFDLIQ
TAYTLGHSTSSRQDVSKIPLCIDESTPQHSIDFKMQKNCNNEYKVSSNYNTESSSSEGNH
SVTLSPCLSQFKQDKQHLVLGTRGSLFENAHILREEQAFPQNSMEISKTETFSNDSVRTS
AEVCSPNPEEPETYFETEAVEIAKAFMEDDELTDSEPPGHPGHSLSTCQKKEGVLLNSRA
GKRRGGALVSVGESQIKRSLLNEFDRIKENEEKSLKASKCTPDGTVKDRKRFTHHISLEP
VTCGPSCTTSNRQEIQNLNCTAPDQEFLSTSHLYEHLTLEKSSTSLPVSRQPFYKVPAVR
SENTRYSTTASKPVKVFVPPFKTKSHFHRDECFVSRDINLEENKQKQQNIDDCGSDDSEN
NVDGSEIHQFNKNCSNQGTVKIFPKCKEEPLADLMTSLQNARKIQDIRIKEKEKQHIFPQ
PGSLYLAKTSSLPRISLKAAVGGRVPSACSHKQLYMYGVSIHCMKINSKNAESFKFHIQD
YFGKEDLQAGKGIQVADGGWLIPDNDGKAGKEEFYRALCDTPGVDPKLISRVWVCNHYRW
IIWKLAAMEVAFPQEFASRCLNPERVLLQLKYRYDVEIDRSRRSAIKKILERDDIAAKTL
VLCVSDIVSSNTNTSEGSGDKASADIKKAAVVELTDGWYAVRAQLDPPLTTLLKSGRLAV
GQKVVTHGAELVGSPDACAPLEAPESLMLKISANSTRPARWDARLGFLPDPRPFPLCLSS
LFSDGGAVGCADVVVQRVYPVQWVEKTSSGLYIFRNEREEEKEAAKHAEAQQKKLEALFS
RIQAQFEEREANPAKRCTSSHALTRQQVRALQDGAELYEAVRSAPEPGYLEGCFSEEQLR
ALNKHRQMLDAKRQAQMQLEFRKAVEHAEQGERGLARDVAALWRLRVVSHERKEDCSVIL
SIWRPSSDLHSLLTEGKRYRIYHLAASKSKSKSERANIQLTTQYQQLTASDEILLQAYRP
RQALCFSRLLEPDFQPPYSEVDLIGFVVSVVKKIGLAPLVYLTDECYNFLAVKFWIDLNE
DIIRPHMLVAASNLQWRPESNSGIPTLFAGDFSVFSASPKEGHFQERFNKMKTVVENVDT
FCNDAAEKLTHFLGVSDPKRAPPSTDCTSELHTAQTGLGTRNKCLMSSPSDEINYQSALS
LCCPKGKSVSTPIAAQITSKSCAEQKAVNDPKNSKKRRALDFLSRVPLPPPVSPICTFVS
PAAQKAFQPPRICDTKYETPKLDFPQMTPLKKASAVSLLESNSIADEELAMINTQALLSG
SAGENQLPSARESRRTAPSSSGDYLGQKGHCAVPLVTGQENSQASTGECKSNLQDTSRIK
NLSKRLQRRQKHK
Download sequence
Identical sequences ENSCPOP00000004635 10141.ENSCPOP00000004635 ENSCPOP00000004635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]