SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004781 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004781
Domain Number 1 Region: 232-333
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.11e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 86-197
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.029
Further Details:      
 
Domain Number 3 Region: 5-61
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000093
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004781   Gene: ENSCPOG00000005317   Transcript: ENSCPOT00000005374
Sequence length 818
Comment pep:known_by_projection scaffold:cavPor3:scaffold_20:6489188:6509106:1 gene:ENSCPOG00000005317 transcript:ENSCPOT00000005374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVR
KLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGH
SVFDFTHPCDHEEMKEMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWK
VLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDM
KFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAK
RGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMK
ITQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFSSNDTETDDQQLEEVPL
YNDVMFPSSSEKLQNINLAMSPLPASESPKPLRSSTDPALNQEVALKLEPNPESLELSFT
MPQIQDQPVSPSDGSTRQSSPEPNSPSEYCFDVDSDMVNVFKLELVEKLFAEDTEAKNPF
STQDNDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPQSVSTTTAFQQTQMQEPTIT
TSTANTTTPTTTEELKTVTKDSMEDIQILIVSPSPTHLLKETTRATTSPPYSDTQSRTAS
PNRAGKGVIEQTEKSHPRSPNVVPVTLSQRNTIPEEELNPKIQALQNAQRKRKMEHDGSL
FQAVGIGTLLQQPDDRAVTTSLSWKRVKGCKSSEQSGMEQKTIILIPSDLACRLLGQSMD
ESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences 10141.ENSCPOP00000004781 ENSCPOP00000004781 ENSCPOP00000004781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]