SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004849 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004849
Domain Number 1 Region: 35-64,181-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.33e-57
Family G proteins 0.0000000465
Further Details:      
 
Domain Number 2 Region: 64-183
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.83e-42
Family Transducin (alpha subunit), insertion domain 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004849   Gene: ENSCPOG00000005387   Transcript: ENSCPOT00000005445
Sequence length 356
Comment pep:known_by_projection scaffold:cavPor3:scaffold_21:28275051:28477548:-1 gene:ENSCPOG00000005387 transcript:ENSCPOT00000005445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRCCCLSAEEKEAQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIH
GSGYSDEDRKGFTRLVYQNIFTAMQAMIRAMDSLRIQYVCEQNKENAQIIRKVDVDKVSM
LSRDQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIAMPSFVPTQQDVLRVR
VPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECD
NENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVK
AARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFTAVKDTILQLNLREFNLV
Download sequence
Identical sequences H0V5C1
10141.ENSCPOP00000004849 ENSCPOP00000004849 XP_003472275.1.53824 ENSCPOP00000004849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]