SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004925 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004925
Domain Number 1 Region: 57-126
Classification Level Classification E-value
Superfamily Caspase-like 7.33e-21
Family Caspase catalytic domain 0.0000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004925   Gene: ENSCPOG00000005469   Transcript: ENSCPOT00000005528
Sequence length 129
Comment pep:novel scaffold:cavPor3:scaffold_11:2069577:2089588:-1 gene:ENSCPOG00000005469 transcript:ENSCPOT00000005528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQMADDQEYVGEQGAGEFARTDSVDAKPDRTSFMSILLKKKKNDSIRSAGGTENEVPTYK
YNMNFEKVGKCIIINNKNFEPVTGMGVRNGTDRDADALFRCFRNLGFDVVVYNDCTCAKM
QDLLKQGED
Download sequence
Identical sequences 10141.ENSCPOP00000004925 ENSCPOP00000004925 ENSCPOP00000004925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]