SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004936 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004936
Domain Number 1 Region: 270-365
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000733
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 99-160
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 3 Region: 15-56
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000995
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004936   Gene: ENSCPOG00000005481   Transcript: ENSCPOT00000005540
Sequence length 824
Comment pep:known scaffold:cavPor3:scaffold_31:4637884:4668888:-1 gene:ENSCPOG00000005481 transcript:ENSCPOT00000005540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSF
FDVALKSSPTDRNGGQDDCGAPFRSRLNLQEGEFLLQALNGFVLAVTTDALVFYVSSTIQ
DYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWAFNPSQCSDSGQAIPEPHGLPQPGVSY
TTERLPPENSPLMERCFVCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGSVLPPQL
ALFAIATPLQSPSILELRTKNFLFRTKHKLDFTPIGCDAKGQIVLGYTEAELCAKGSGYQ
FIHAGDMLHCAEYHMRMIKTGESGMTVFRLLTKHNRWIWMQSNARVVYKNGRPDYIIATQ
RALTDEEGREHLRKRGVKLPFMFTTGEAVLYETSKSFPPGMDSLPTQTKSATNGQGSATL
STEKGSPHPTSLLASMMQQDESIYHCPASNTVPFETNFFNDLIEYSNWQDGIAPMRNDNI
FKHKQIGQTQEMNPMLSGGHTVPFSDNKNSELYSIMKNLGIDFEDIKCMQNEEFFRTDAS
SEVDFRDIDVRDEILTYVQDSLSKSPFLSSEYQQQQAVALNSSCMVQEQLELEQQQQLQL
HGKPIVVEPQQQLCQKMKHMQVNGLLGNWSAGSSVPFSCPPQDLQQYNMFPDLHGANPEF
PYKSELETVPYTQNFAPCEQPLLPQRSKGTQLEFPIENFEPSLYPTTSNLEGFASCLQVP
ENQRHGINPQSSIVTPQTCYAGTMSAYQCQPEPQHSHVDQMQYNPAVPGPQVFLNKFPNG
GVLNDVYPVGLNDINNTQAATHLQPFHHPAETRPFPDLTPSGFL
Download sequence
Identical sequences ENSCPOP00000004936 10141.ENSCPOP00000004936 ENSCPOP00000004936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]