SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004955 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004955
Domain Number 1 Region: 92-178
Classification Level Classification E-value
Superfamily PUA domain-like 9.32e-19
Family PUA domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004955
Domain Number - Region: 51-88
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0981
Family Hypothetical protein APE0525, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004955   Gene: ENSCPOG00000005502   Transcript: ENSCPOT00000005561
Sequence length 181
Comment pep:known_by_projection scaffold:cavPor3:scaffold_69:613152:622440:1 gene:ENSCPOG00000005502 transcript:ENSCPOT00000005561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAADTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
Download sequence
Identical sequences A0A286XW18
10141.ENSCPOP00000004955 XP_003465639.1.53824 ENSCPOP00000004955 ENSCPOP00000004955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]