SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005002 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005002
Domain Number 1 Region: 244-657
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 7.73e-91
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00046
Further Details:      
 
Domain Number 2 Region: 106-242
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.95e-38
Family Ferredoxin domains from multidomain proteins 0.00022
Further Details:      
 
Domain Number 3 Region: 33-105
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.56e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005002   Gene: ENSCPOG00000005555   Transcript: ENSCPOT00000005614
Sequence length 724
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:39857037:39884518:-1 gene:ENSCPOG00000005555 transcript:ENSCPOT00000005614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPLRRALAGLSKSSRAEHVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQ
IPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKTKKAREGVMEF
LLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQC
TRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFT
ARPWETRKTESIDVMDAIGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKR
QRLTEPMVRNEKGLLTHTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALIALKDLLN
RVDSDTLCTEEIFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIR
KSWLHNDLQVALIGSPVDLTYRYNHLGESPKVLQDIASGNHPFSQVLKAAKKPMVVLGSS
ALQRNDGAAILAAVSSIAQEVRVTSGVAGGWKVMNILHRVASQVAALDLGYKPGVEAIRK
VLFLLGADGGCVTRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSGTYVNTEGRA
QQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRSRLEEVSPNLVRYDDVEGAN
YFQQASELAKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQAVEE
PSIC
Download sequence
Identical sequences ENSCPOP00000005002 10141.ENSCPOP00000005002 ENSCPOP00000005002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]