SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005190 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005190
Domain Number 1 Region: 125-219
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.31e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 6.21e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005190   Gene: ENSCPOG00000005756   Transcript: ENSCPOT00000005818
Sequence length 221
Comment pep:known_by_projection scaffold:cavPor3:scaffold_95:3545297:3548239:-1 gene:ENSCPOG00000005756 transcript:ENSCPOT00000005818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHS
Download sequence
Identical sequences A0A286XQV1
ENSCPOP00000005190 XP_003463740.1.53824 XP_004638928.1.9945 10141.ENSCPOP00000005190 ENSCPOP00000005190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]