SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005415 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005415
Domain Number 1 Region: 306-636
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-62
Family WD40-repeat 0.000051
Further Details:      
 
Domain Number 2 Region: 43-320,367-520
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.53e-52
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005415   Gene: ENSCPOG00000005998   Transcript: ENSCPOT00000006061
Sequence length 801
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:22057965:22064053:1 gene:ENSCPOG00000005998 transcript:ENSCPOT00000006061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNNMAETVAGVGRFKANYAVERKIEPFYKGGKVQLDQTGHHLFCICGNRVNVLDVASGSV
LQSLEQEDQEDITAFDLSPDNEVLVTASRALLLAQWVWREGSVTRLWKAIHTAPVATMAF
DPTSTLLATGGCDGAVRVWDVVQHYGTHHFRGSPGVVHLVAFHPDPTRLLLFSSAVDAAI
RVWSLQDRSCLAMLTAHYSAVTSLTFSADGHSMLSSGRDKICIVWDLQSHQATKTVPVFE
SVESAVLLPEEPAPALGVKNSGLHFLTAGDQGILRVWEAASGQCVYTQTQLPGPGLELTH
CSLVRAAGLLLSVTADHNLLLYEACSLQLQKQFAGYSEEVLDVRFLGPKDSHIIVASNSP
CLKVFELQTSACQILHGHTDIVLALDVFRKGRLFASCAKDQSIRIWRMNKAGQVSCVAQG
SGHTHSVGTIYCSRLKESFLVTGSQDCTVKLWPLPEALLSKSTTPDSDPILLQAQTTQRC
HEKDINSVAISPNDKLLATGSQDRTAKLWTLPQCQLVGVFSGHRRGLWCVQFSPMDQVLA
TASADGTIKLWSLQDLSCLKTFEGHDASVLKVAFVSRGTQLLSSGSDGLLKLWTIKNNEC
VRTLDAHEDKVWGLHCNQLDDHALTGASDSRVILWKDVTEAEQAEEQAKREEQVVKQQEL
DNLLHEKRYLRALGLAISLDRPHTVLTVIQAIRRDAEACEKLEATVLRLRRDQKEALLRF
CVTWNTNARHCHEAQAVLSVLLQHEAPEELLAYEGVRATLEALLPYTERHFQRLSRTLQA
ATFLDFLWHNMKLSPLPAAPP
Download sequence
Identical sequences ENSCPOP00000005415 10141.ENSCPOP00000005415 ENSCPOP00000005415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]