SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005659 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005659
Domain Number 1 Region: 1024-1315
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-72
Family Protein kinases, catalytic subunit 0.0000431
Further Details:      
 
Domain Number 2 Region: 131-230
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000114
Family N-terminal PAS domain of Pas kinase 0.00000905
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005659
Domain Number - Region: 241-320
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000192
Family Heme-binding PAS domain 0.025
Further Details:      
 
Domain Number - Region: 346-385
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00715
Family Heme-binding PAS domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005659   Gene: ENSCPOG00000006277   Transcript: ENSCPOT00000006342
Sequence length 1350
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:23152859:23173587:1 gene:ENSCPOG00000006277 transcript:ENSCPOT00000006342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDPSPPDVNENGRCQSGSVSVPSPAEGPSTQAASEPSKPLSTRRHLSRKDGLSKLCQSR
IALSEDRWSSYCLSSLVAQNICTGRVRCPTAPEHVDPAAPLGSASCCSLLRGLSSGCSMP
LLPGPVYNPNKAIFTVDAKTTEILVANDKACGLLGYSSHDLIGQKLVQFFVQPDSEVAEA
LSEEHVEADGHAAVVFGTVADIVSRSGDKIPVSVWMKRVRQERGLCCVVVLEPVERISAW
VAFQGEGTITSCDDLFAHLHGFSSGEDVVGQHITDLIPSLRLPSPGQPVPENLKIQRSVG
RAKDGTTFPLSLKLKPKQDGEAAEGEAVPEQGYWASVWVFCTISGLITLLPDGTIYGINH
NFALMLFGYGKTELLGKKITFLIPGFYHYMDITYDSSSQYPSSCLDFSSENGHGEMTLDT
SQGWSAGVYRNPKFDSVLAGHCVLPPDIMQKPVGSQGIAGGMQTQLETGCQLPATCSPGS
SPGEDSVLDGYPLAQDKRSLPTNQQSTPEEHVLAHEKQSPSENQQDVSEESPPTHEEWLL
RKDPQDSQDGSPPALSVRTLPRDQQDTALGSVGPVVAQSSPQDLLGESGSEPADTKPFVS
CEEPNPPVPPEDKCSNVGMGSLHQEAQWALTAASRPEPHAAGQPAGGDLLTYCPAYRSEW
LPWPPGHSGVACVSFGTPTLDEPWPGRRASHEELQVCLVKEQLSRLSFEGVSRLESVPTE
HHPYTASLSSSLEGRDLCGSHLGSSSACYALATDLPDALELVEAREAAMNSYSWNLRELL
LSDDTDGTSSNCSYTTSEPGGSPSPSAVSSDFNVHTLHKQRPGAFGDRERLLLTGTYFNL
GEGQGSQESNLEHDSTELPVMDLASERYKMSNSQSSELPAMDASQEDARASAEDPKLSAW
VTSTPVKPGAASLCREIQEGTYSGYCYHRDGLWLSICFEVKLVELQGPVSLFCCWLVKDL
LHSHRSSATRTRLLLASLPSSTHSMPDPSGRGLGEVLRTKPWAEEAPTPMELEGLAACEG
EYSRKYITLRPLGSGAFGFVWIAMDKEQNKEVVVKFIKKEKVLEDCWIEDTKLGKVTLEI
AILSHVEHPNIIKVVDVFENQGFFQLVMEKHGSGLDLFAFIDQHPSLDEPLASHIFRQLL
SAVGYLRSKGIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEV
LMGNPYRGPELEMWSLGVTLYTLIFEENPFCEVEETMEATIHPPYLVSQELMSLLSGLLH
PDPRQRTTLEKLVTDPWVTQPVNLAQYTWEEVCRISKPESGLLSTASLQHRTGSRSLSEA
GSEFQAHPAPEEAPSSQHCLGPEDPSPLAS
Download sequence
Identical sequences ENSCPOP00000005659 ENSCPOP00000005659 10141.ENSCPOP00000005659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]