SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005809 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005809
Domain Number 1 Region: 421-907
Classification Level Classification E-value
Superfamily ALDH-like 5.5e-164
Family ALDH-like 0.000000000905
Further Details:      
 
Domain Number 2 Region: 7-207
Classification Level Classification E-value
Superfamily Formyltransferase 8.9e-51
Family Formyltransferase 0.00000000357
Further Details:      
 
Domain Number 3 Region: 211-312
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.83e-26
Family Post formyltransferase domain 0.0000017
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005809
Domain Number - Region: 329-423
Classification Level Classification E-value
Superfamily ACP-like 0.00027
Family Acyl-carrier protein (ACP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005809   Gene: ENSCPOG00000006449   Transcript: ENSCPOT00000006514
Sequence length 908
Comment pep:known_by_projection scaffold:cavPor3:scaffold_16:18485099:18539975:1 gene:ENSCPOG00000006449 transcript:ENSCPOT00000006514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETPSAAMKIAVIGQSLFGQEVYCHLRKEGHKIVGVFTIPDKDGKADPLGLEAEKDGVPVF
KFPRWRARGQALPDVVAKYQALGAELNVLPFCSQFIPMEVIDAPLHGSIIYHPSLLPRHR
GASAINWTLIHGDKKGGFTIFWADEGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIK
GMVEAVRLIAEGKAPRLRQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAW
TEACGQKLTFFNSTLNTSGLVPEGEDLLIPGARRPGVVTKAGLILFGNDDKMLLVKNMQL
EDGKMIPASQFFKGAASSALELTEAELAIAEAVRSAWKRILPNVPDVEDSTDFFKSGAAS
VDVVRLVEEVKELCDGLELENEDVYMATMFGDFIQLLVRKLRGEDEEGECVIDYVEKAVN
KLTVRMPHQLFIGGTFVDAEGSKTYDTINPTDGSVICQVSLAQVSDVDKAVAAAKDAFEN
GLWSKISARDRGRLLYRLADLMEEHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFA
GWCDKIQGCTIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTV
VIKPAQVTPLTALKFAELTVKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTEV
GKHIMKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLF
VENSIHDQFVQKVVEEVKKMKIGNPLDRDTNHGPQNHQAHLTKLLEYCQRGTKEGATLVY
GGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPIMIISRFADGDVDTVLSRANATEFGL
ASGVFTRDINKALYVSDKLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLR
IKTVTFEY
Download sequence
Identical sequences ENSCPOP00000005809 10141.ENSCPOP00000005809 ENSCPOP00000005809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]