SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006007 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006007
Domain Number 1 Region: 575-679,793-908
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.3e-51
Family Phosphate binding protein-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 126-497
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-24
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006007   Gene: ENSCPOG00000006667   Transcript: ENSCPOT00000006735
Sequence length 1114
Comment pep:known_by_projection scaffold:cavPor3:scaffold_27:22740879:22899382:-1 gene:ENSCPOG00000006667 transcript:ENSCPOT00000006735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPSLWWLLSRVCLLLPPPCALVLAGVPGSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRATSRAPDSSRAGAQRDEAEPGTWRPLAPSQGARWLGSALHGRGPPGARKPGEGSRAE
TLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFTF
LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSSVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNSWYNFSLLLCQEDWNVTDFLLFTQNNSKFHLGSIINITAN
LSSTKDLFSFLQVQLESVKNSTATVVMLGCDMESIRQIFEISTQFGVTPSELHWVLGDSQ
NVEELRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALIPSTMNCM
DVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIVSSENNFFIWNLQHDPMGKPMWTR
LGSWQGGRIVMDYGIWPEQAQRHKAHFQHSSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLDPMTNDSSVLDSLFTSLHSSNDTVPIKFKKCCYGYCIDLLEKLAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLNGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRSKVFSFSSAL
NVCYALLFGRTVAMKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQNLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFM
DVLHDKWYKMVPCGKRSFTVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLQYWLHTSQRFHRALNTSYVEEKQQRFKSKHVEKRTNMGPRQLMVWNTSSLG
HDNQRKHIFSDEGEPNQLGIQTHQDIPLPARRELPATVTTNGKANSLNLARNSVMQELSE
LEKQIQVIRQELQLAVSRKTELEEYQRTNRTCES
Download sequence
Identical sequences H0V8B4
ENSCPOP00000006007 XP_003470954.1.53824 ENSCPOP00000006007 10141.ENSCPOP00000006007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]