SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006232 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006232
Domain Number 1 Region: 38-185
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-28
Family C-type lectin domain 0.00000319
Further Details:      
 
Domain Number 2 Region: 440-506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 254-320
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000625
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 502-568
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000681
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 199-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000834
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 378-443
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000848
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 315-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000987
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 8 Region: 634-699
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 579-644
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000104
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006232   Gene: ENSCPOG00000006911   Transcript: ENSCPOT00000006980
Sequence length 767
Comment pep:known_by_projection scaffold:cavPor3:scaffold_39:6614421:6637077:-1 gene:ENSCPOG00000006911 transcript:ENSCPOT00000006980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANCLKAIWNLRFRGVVLGAAQLLWLGVFISEPTNRMEVAAWTYNYTAKAYTWNYSRIFCQ
RHFTDLVAIQNKNEIAHLNEVIPFYSSYYWIGIRKINNTWTWVGTKKPLTEEAENWADNE
PNNKGNNQDCVEMYIKRKDALGKWNDEPCSKRKRALCYTASCQPTSCSQQGECIETIGNY
TCSCYPGFYGPECEYVKECGAFDLPRHVSMNCDHPLGSFSFNSECTFQCAEGYELAGPRG
TKCLASGMWTDKPPQCVAVQCQHLEAPGSGTMDCEHPLAPFAYGSSCKFRCQPGYQVRGV
DTLHCVGSGQWTAPLPACEAVTCSPLGSPVHGGVHCSSSSAAFQYNTSCSFHCAEGFMLS
GAGVLRCGDLGQWSAPAPVCQALQCQEVSAPSKAQMNCSHPFGAFRYGSVCDFTCDEGSL
LVGASTLQCLATGHWSAAPPACQATSCAPLLSPQHGMVSCIQPLRSASYKSTCHFTCDEG
FSLSGSERVDCTPSGQWTGSPPTCTAIKCPELFAPQWGSLDCSHTYGEFRVGSSCRFSCD
KGFKLEGSSDAECTASGRWSVPLPTCKAVGLTPAAVVQCPALATPGQGTMLCRHHLGTFG
LNTTCYFGCKAGFTLIGDNALKCTPSGQWTAVTPACRAIKCPDLHMDPPLVMNCSNPWGN
FHYGSDCTFHCPEGQLLNGSARTTCQDNGHWSDTMPTCQEAALTVQEALTYAGGAVASTT
GLAMGGTLLALLRKRLRKKDDGKCPLSPQSHLGTYGVFTNTAFDPNP
Download sequence
Identical sequences ENSCPOP00000006232 ENSCPOP00000006232 10141.ENSCPOP00000006232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]