SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006461 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006461
Domain Number 1 Region: 20-229
Classification Level Classification E-value
Superfamily PHP domain-like 4.71e-45
Family RNase P subunit p30 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006461   Gene: ENSCPOG00000007164   Transcript: ENSCPOT00000007235
Sequence length 268
Comment pep:known_by_projection scaffold:cavPor3:scaffold_137:987061:1013248:1 gene:ENSCPOG00000007164 transcript:ENSCPOT00000007235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFADLDLRASSDLKALRGMVETAAHLGYSVVAINHVVDFKEKKQEIEKPVVVSELFTT
LPIVQGKSRPIKILTRLTIIVTDPSHCNVLRATSSRVRLYDIIAVFPKTEKLFHVACTHL
DVDLVCVTVTEKLPFYFKRPPVNVAIDRGLGFELVYSPAIKDSTIRRYTISNALNLMQIC
KGKNIIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSINCRAALLHGETRRTAFG
IISTVKKPRPSEGDDDSLPACKKAKCEG
Download sequence
Identical sequences A0A286XVY3
10141.ENSCPOP00000006461 ENSCPOP00000006461 ENSCPOP00000006461 XP_003462406.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]