SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006878 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006878
Domain Number 1 Region: 389-955
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.04e-133
Family alpha-mannosidase, C-terminal domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 1-307
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.6e-91
Family alpha-mannosidase 0.0000203
Further Details:      
 
Domain Number 3 Region: 311-412
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 8.5e-26
Family alpha-mannosidase, domain 2 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006878   Gene: ENSCPOG00000007632   Transcript: ENSCPOT00000007705
Sequence length 958
Comment pep:known_by_projection scaffold:cavPor3:scaffold_166:20585:40742:1 gene:ENSCPOG00000007632 transcript:ENSCPOT00000007705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QESMRAYAANVYTSVVAELAQGQRRRFIAVEQEFFRLWWDQVASGQQKAQVHQLLAQGRL
EFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPRFSWHVDPFGASATTPTLFAL
AGFHAHLISRIDYDLKDAMQKAQGLQFMWRGSPSLSTQQQIFTHVMDQFSYCTPAHLPFS
NRSGFYWNGVAVFPEPPPDGVYPNMSEPVTPANVELYAQVLVANVKQRAAWFRTPHVLWP
WGCDKQFFNASVQFANMDPLLDHINSRAAELGVTAEYATLDDYFRALHELNVTWGVRNHQ
DFLPYASEQQQAWTGFYASRSTLKGLARQASALLYAGESMFTRYMWPAPRGTLDPTWALQ
QLQQLRWAVSEVQHHDAITGTESPKVSNMYVEHLAMGTRGVHKLMASITQDSAQHVALGS
DSGTRPEGHLASVYNPLAWTVTTIITLTVSFSRASVTDESGRLVPAQIQRSTRDPSAYDL
LILVTIPGLSYRHYSVQPTTGTRAAATMASTVWFGRRQRHTSRGNRRLVTVVNNCYTVLL
DPDTNLLHSVQERQSNRTVRMSQEFLEYHANGDATRGPISDNYLFAPNETAVPAWEAVGL
EVVAGELVTEIRQRFYRDATAQAYTYAIHSRLAHVSQGPGAELLCHRIEQEYRVGPLELN
REAVLRTSSDLDSQQVLYSDNNGYQMHRRPYRAYESNTIARNYYPMVQSAFIEDSRSRLV
LLSERAHGVSSPGSGQVEVMLHRRLWNNLAWDLNYNLTLNDTSIVHPVLWLLLGSQAVTT
ALHPQSALALQHRPVVLLRELPGRPASRPQAPQQQAAVTLPPNLHLQILSIPGWNYSSSH
SEHMRALRTSHRGQAQADLRRVLLRLHHLYEAGEDPVLSQPVTVNLEAVLRGLGAVAAVQ
ERSLTGTWDVHTMQRWSWRTKPGRQTGRPASHSWPPSNHKVTVHPKEILTFFVHFRQQ
Download sequence
Identical sequences ENSCPOP00000006878 10141.ENSCPOP00000006878 ENSCPOP00000006878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]