SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007055 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007055
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000863
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007055   Gene: ENSCPOG00000007834   Transcript: ENSCPOT00000007909
Sequence length 305
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:14752455:14756851:1 gene:ENSCPOG00000007834 transcript:ENSCPOT00000007909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGVQSSGQVHAFGNCADSDILEEDAEVYELRSRGKEKIRTSTSRDRLD
DIILLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRAIKIPVKKFSSLTES
LYPPKGRQASRPSPVHYAPEQQEILSANDCLSSSESAGSFLKEVDRDIEQIVKCTDTKKE
NLNEVVSALSTQQIRFEPDNKNTRRKDPYYGADWGIGWWTAVVIMLVVGIITPVFYLLYY
ELLAKVDVSHHSTVDSSHLHSGITPPSQHKEMESGITPTKGIHGGQQEGHGLYGDSQPAA
AQREA
Download sequence
Identical sequences A0A286XNI3
ENSCPOP00000007055 10141.ENSCPOP00000007055 ENSCPOP00000007055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]