SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007187 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007187
Domain Number 1 Region: 237-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.01e-56
Family Decarboxylase 0.000000718
Further Details:      
 
Domain Number 2 Region: 12-205
Classification Level Classification E-value
Superfamily PRTase-like 2.23e-45
Family Phosphoribosyltransferases (PRTases) 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007187   Gene: ENSCPOG00000007985   Transcript: ENSCPOT00000008060
Sequence length 480
Comment pep:known_by_projection scaffold:cavPor3:scaffold_87:4474998:4487146:-1 gene:ENSCPOG00000007985 transcript:ENSCPOT00000008060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGATLGPLVASLYDVQALKFGDFVLKSGLTSPVYIDLRGVISRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTHQIPMLMRRKETKNYGTKCLVEGALNPGETCL
VIEDVVTSGGSVLDTVEVLQKAGLKVTDAVVLLDREQGGRDKLQAHGIRLHAVCTLSQML
EILEQQQKINPEVVKRVKQFIRENVFTATQQNGSLLRMSKAPEELSFAARAELPGIHPVA
SKLLRLMQKKKTNLCLSADVSEARELVQLADTLGPSICVLKTHVDILDDFTLDVMKELTA
LARQHEFLIFEDRKFADIGSTVKKQYEGGVFKIASWADIVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSAGSLATGDYTNAAVRMAEHHCEFVIGFISGSRVSMKPEFLHLTPGVQ
LEAGGDHLGQQYNSPQEVIGRRGSDIIIVGRGILSAPNRLEAAEIYRKAAWEAYLSRLAV
Download sequence
Identical sequences H0VBB4
ENSCPOP00000007187 XP_003464162.1.53824 ENSCPOP00000007187 10141.ENSCPOP00000007187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]